Web stats for Pacecareerchandigarh - pacecareerchandigarh.com
Join Digital Marketing Course (Classroom Training) + Live Projects. Internship + 100% Job Placement | Daily Class | Best Digital Marketing Course in Chandigarh | Call +91-99583-90006
4.67 Rating by ClearWebStats
pacecareerchandigarh.com is 3 years 3 months 3 weeks old. This website has a #4,843,503 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, pacecareerchandigarh.com is SAFE to browse.
Traffic Report of Pacecareerchandigarh
Daily Unique Visitors: | 99 |
Daily Pageviews: | 198 |
Estimated Valuation
Income Per Day: | $ 1.00 |
Estimated Worth: | $ 240.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 4,843,503 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is pacecareerchandigarh.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 2 |
H3 Headings: | 12 | H4 Headings: | 61 |
H5 Headings: | Not Applicable | H6 Headings: | 10 |
Total IFRAMEs: | Not Applicable | Total Images: | 26 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 162.241.148.33)
Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute
- shrivishwakarmasafetytraininginstitute.com
The Shine English Academy – DREAM | LEARN | SPEAK
- theshineenglishacademy.com
Urvashi International Packers and Movers|Movers and Packers Hyderabad
- urvashiinternationalpackers.com
Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers
247 Best Pill Pharma – Order Prescription Drugs in our Online shop
- 247bestpillpharma.com
HTTP Header Analysis
HTTP/2 200
date: Tue, 12 Jan 2021 11:56:25 GMT
server: Apache
link: <https://pacecareerchandigarh.com/wp-json/>; rel="https://api.w.org/"
vary: Accept-Encoding
content-encoding: gzip
content-type: text/html; charset=UTF-8
date: Tue, 12 Jan 2021 11:56:25 GMT
server: Apache
link: <https://pacecareerchandigarh.com/wp-json/>; rel="https://api.w.org/"
vary: Accept-Encoding
content-encoding: gzip
content-type: text/html; charset=UTF-8
Domain Information for pacecareerchandigarh.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
pacecareerchandigarh.com | A | 14396 |
IP:162.241.148.33 |
pacecareerchandigarh.com | NS | 86400 |
Target:ns1.bh-ht-17.webhostbox.net |
pacecareerchandigarh.com | NS | 86400 |
Target:ns2.bh-ht-17.webhostbox.net |
pacecareerchandigarh.com | SOA | 86400 |
MNAME:ns1.bh-ht-17.webhostbox.net RNAME:root.bh-ht-17.webhostbox.net Serial:2021010700 Refresh:86400 Retry:7200 Expire:3600000 |
pacecareerchandigarh.com | MX | 14400 |
Target:mail.pacecareerchandigarh.com |
pacecareerchandigarh.com | TXT | 14400 |
TXT:v=spf1 ip4:162.241.148.33 a mx include:websitewelcome.com ~all |
Similarly Ranked Websites to Pacecareerchandigarh
A Primitive Place Home
- aprimitiveplace.org
Our site is full of primitive and colonial inspired homes, gardens, decorating and craft ideas, trash to treasure makeovers, crafting tutorials and more!
Read One Piece Manga And Watch All One Piece Episodes
- onepieceonline.info
Here you can Read all One Piece Manga And Watch All Anime One Piece Episodes and Released movies in Both English Subbed and Dubbed.
Full WHOIS Lookup for pacecareerchandigarh.com
Domain Name: PACECAREERCHANDIGARH.COM
Registry Domain ID: 2583009705_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2021-01-07T09:11:21Z
Creation Date: 2021-01-06T12:36:36Z
Registry Expiry Date: 2022-01-06T12:36:36Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2021-01-12T11:56:21Z
Registry Domain ID: 2583009705_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2021-01-07T09:11:21Z
Creation Date: 2021-01-06T12:36:36Z
Registry Expiry Date: 2022-01-06T12:36:36Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2021-01-12T11:56:21Z